RegulonDB RegulonDB 10.8: Amino acid Sequence
ribosome-dependent mRNA interferase toxin YoeB Amino Acid Sequence


Size: 84

Fasta

 

>ribosome-dependent mRNA interferase toxin YoeB E. coli K12. Version NC_000913.3 GI:556503834
MKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRI
TEEHRLVYAVTDDSLLIAACRYHY
              
                            

Download fasta file
RegulonDB