RegulonDB RegulonDB 10.10: Amino acid Sequence
erythronate-4-phosphate dehydrogenase Amino Acid Sequence


Size: 378

Fasta

 

>erythronate-4-phosphate dehydrogenase E. coli K12. Version NC_000913.3 GI:556503834
MKILVDENMPYARDLFSRLGEVTAVPGRPIPVAQLADADALMVRSVTKVNESLLAGKPIK
FVGTATAGTDHVDEAWLKQAGIGFSAAPGCNAIAVVEYVFSSLLMLAERDGFSLYDRTVG
IVGVGNVGRRLQARLEALGIKTLLCDPPRADRGDEGDFRSLDELVQRADILTFHTPLFKD
GPYKTLHLADEKLIRSLKPGAILINACRGAVVDNTALLTCLNEGQKLSVVLDVWEGEPEL
NVELLKKVDIGTSHIAGYTLEGKARGTTQVFEAYSKFIGHEQHVALDTLLPAPEFGRITL
HGPLDQPTLKRLVHLVYDVRRDDAPLRKVAGIPGEFDKLRKNYLERREWSSLYVICDDAS
AASLLCKLGFNAVHHPAR
              
                            

Download fasta file
RegulonDB