RegulonDB RegulonDB 10.9: Amino acid Sequence
small toxic polypeptide LdrB Amino Acid Sequence


Size: 35

Fasta

 

>small toxic polypeptide LdrB E. coli K12. Version NC_000913.3 GI:556503834
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
              
                            

Download fasta file
RegulonDB