RegulonDB RegulonDB 10.9: Amino acid Sequence
CPS-53 (KpLE1) prophage; prophage CPS-53 recombination directionality factor and response regulator inhibitor Amino Acid Sequence


Size: 66

Fasta

 

>CPS-53 (KpLE1) prophage; prophage CPS-53 recombination directionality factor and response regulator inhibitor E. coli K12. Version NC_000913.3 GI:556503834
MQHELQPDSLVDLKFIMADTGFGKTFIYDRIKSGDLPKAKVIHGRARWLYRDHCEFKNKL
LSRANG
              
                            

Download fasta file
RegulonDB