RegulonDB RegulonDB 10.9: Amino acid Sequence
protein/nucleic acid deglycase 3 Amino Acid Sequence


Size: 196

Fasta

 

>protein/nucleic acid deglycase 3 E. coli K12. Version NC_000913.3 GI:556503834
MSASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLV
EVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFP
IGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHE
VASQLVMAAGIYNYYE
              
                            

Download fasta file
RegulonDB