RegulonDB RegulonDB 10.9: Amino acid Sequence
flagellar basal-body rod protein FlgF Amino Acid Sequence


Size: 251

Fasta

 

>flagellar basal-body rod protein FlgF E. coli K12. Version NC_000913.3 GI:556503834
MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVEGLSLPTRTLVTAS
TPGADMTPGKMDYTSRPLDVALQQDGWLAVQTADGSEGYTRNGSIQVDPTGQLTIQGHPV
IGEAGPIAVPEGAEITIAADGTISALNPGDPANTVAPVGRLKLVKATGSEVQRGDDGIFR
LSAETQATRGPVLQADPTLRVMSGVLEGSNVNAVAAMSDMIASARRFEMQMKVISSVDDN
AGRANQLLSMS
              
                            

Download fasta file
RegulonDB