RegulonDB RegulonDB 10.10: Amino acid Sequence
putative peptidoglycan hydrolase FlgJ Amino Acid Sequence


Size: 313

Fasta

 

>putative peptidoglycan hydrolase FlgJ E. coli K12. Version NC_000913.3 GI:556503834
MISDSKLLASAAWDAQSLNELKAKAGEDPAANIRPVARQVEGMFVQMMLKSMRDALPKDG
LFSSEHTRLYTSMYDQQIAQQMTAGKGLGLAEMMVKQMTPEQPLPEESTPAAPMKFPLET
VVRYQNQALSQLVQKAVPRNYDDSLPGDSKAFLAQLSLPAQLASQQSGVPHHLILAQAAL
ESGWGQRQIRRENGEPSYNLFGVKASGNWKGPVTEITTTEYENGEAKKVKAKFRVYSSYL
EALSDYVGLLTRNPRYAAVTTAASAEQGAQALQDAGYATDPHYARKLTNMIQQMKSISDK
VSKTYSMNIDNLF
              
                            

Download fasta file
RegulonDB