RegulonDB RegulonDB 10.9: Amino acid Sequence
flagellar hook-length control protein Amino Acid Sequence


Size: 375

Fasta

 

>flagellar hook-length control protein E. coli K12. Version NC_000913.3 GI:556503834
MIRLAPLITADVDTTTLPGGKASDAAQDFLALLSEALAGETTTDKAAPQLLVATDKPTTK
GEPLISDIVSDAQQANLLIPVDETPPVINDEQSTSTPLTTAQTMALAAVADKNTTKDEKA
DDLNEDVTASLSALFAMLPGFDNTPKVTDAPSTVLPTEKPTLFTKLTSEQLTTAQPDDAP
GTPAQPLTPLVAEAQSKAEVISTPSPVTAAASPLITPHQTQPLPTVAAPVLSAPLGSHEW
QQSLSQHISLFTRQGQQSAELRLHPQDLGEVQISLKVDDNQAQIQMVSPHQHVRAALEAA
LPVLRTQLAESGIQLGQSNISGESFSGQQQAASQQQQSQRTANHEPLAGEDDDTLPVPVS
LQGRVTGNSGVDIFA
              
                            

Download fasta file
RegulonDB