RegulonDB RegulonDB 10.9: Amino acid Sequence
IS186/IS421 transposase Amino Acid Sequence


Size: 370

Fasta

 

>IS186/IS421 transposase E. coli K12. Version NC_000913.3 GI:556503834
MNYSHDNWSAILAHIGKPEELDTSARNAGALTRRREIRDAATLLRLGLAYGPGGMSLREV
TAWAQLHDVATLSDVALLKRLRNAADWFGILAAQTLAVRAAVTGCTSGKRLRLVDGTAIS
APGGGSAEWRLHMGYDPHTCQFTDFELTDSRDAERLDRFAQTADEIRIADRGFGSRPECI
RSLAFGEADYIVRVHWRGLRWLTAEGMRFDMMGFLRGLDCGKNGETTVMIGNSGNKKAGA
PFPARLIAVSLPPEKALISKTRLLSENRRKGRVVQAETLEAAGHVLLLTSLPEDEYSAEQ
VADCYRLRWQIELAFKRLKSLLHLDALRAKEPELAKAWIFANLLAAFLIDDIIQPSLDFP
PRSAGSEKKN
              
                            

Download fasta file
RegulonDB