RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2575 domain-containing protein YaaY Amino Acid Sequence


Size: 72

Fasta

 

>DUF2575 domain-containing protein YaaY E. coli K12. Version NC_000913.3 GI:556503834
MCRHSLRSDGAGFYQLAGCEYSFSAIKIAAGGQFLPVICAMAMKSHFFLISVLNRRLTLT
AVQGILGRFSLF
              
                            

Download fasta file
RegulonDB