RegulonDB RegulonDB 10.9: Amino acid Sequence
VOC domain-containing protein YaeR Amino Acid Sequence


Size: 129

Fasta

 

>VOC domain-containing protein YaeR E. coli K12. Version NC_000913.3 GI:556503834
MLGLKQVHHIAIIATDYAVSKAFYCDILGFTLQSEVYREARDSWKGDLALNGQYVIELFS
FPFPPERPSRPEACGLRHLAFSVDDIDAAVAHLESHNVKCETIRVDPYTQKRFTFFNDPD
GLPLELYEQ
              
                            

Download fasta file
RegulonDB