RegulonDB RegulonDB 10.9: Amino acid Sequence
tRNAIle-lysidine synthetase Amino Acid Sequence


Size: 432

Fasta

 

>tRNAIle-lysidine synthetase E. coli K12. Version NC_000913.3 GI:556503834
MTLTLNRQLLTSRQILVAFSGGLDSTVLLHQLVQWRTENPGVALRAIHVHHGLSANADAW
VTHCENVCQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFARTLLPGEVLVTAQHLDDQ
CETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELVQWARQYDLRWIEDESN
QDDSYDRNFLRLRVVPLLQQRWPHFAEATARSAALCAEQESLLDELLADDLAHCQSPQGT
LQIVPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQEVALAREDASPCLRLGAFEI
RRYQSQLWWIKSVTGQSENIVPWQTWLQPLELPAGLGSVQLNAGGDIRPPRADEAVSVRF
KAPGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFYGETLIAAAGVFVTQEGVAEGE
NGVSFVWQKTLS
              
                            

Download fasta file
RegulonDB