RegulonDB RegulonDB 10.9: Amino acid Sequence
modulator of Rho-dependent transcription termination Amino Acid Sequence


Size: 84

Fasta

 

>modulator of Rho-dependent transcription termination E. coli K12. Version NC_000913.3 GI:556503834
MNDTYQPINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDLVSRKNVEYLVVEAAGET
RELRLDKITSFSHPEIGTVVVSES
              
                            

Download fasta file
RegulonDB