RegulonDB RegulonDB 10.9: Amino acid Sequence
lipoprotein YafT Amino Acid Sequence


Size: 261

Fasta

 

>lipoprotein YafT E. coli K12. Version NC_000913.3 GI:556503834
MNSKKLCCICVLFSLLAGCASESSIDEKKKKAQVTQSNINKNTPQQLTDKDLFGNETTLA
VSEEDIQAALDGDEFRVPLNSPVILVQSGNRAPETIMQEEMRKYYTVSTFSGIPDRQKPL
TCNKNKDKNENEDVASAENMNWMQALRFVAAKGHQKAIIVYQDMLQTGKYDSALKSTVWS
DYKNDKLTDAISLRYLVRFTLVDVATGEWATWSPVNYEYKVLPPLPDKNEASTTDMTEQQ
IMQLKQKTYKAMVKDLVNRYQ
              
                            

Download fasta file
RegulonDB