RegulonDB RegulonDB 10.8: Amino acid Sequence
D-sedoheptulose 7-phosphate isomerase Amino Acid Sequence


Size: 192

Fasta

 

>D-sedoheptulose 7-phosphate isomerase E. coli K12. Version NC_000913.3 GI:556503834
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFNDIFSRYVEAVGREGDVLLGIST
SGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFGYADRIQEIHIKVIH
ILIQLIEKEMVK
              
                            

Download fasta file
RegulonDB