RegulonDB RegulonDB 10.8: Amino acid Sequence
putative glutamine amidotransferase YafJ Amino Acid Sequence


Size: 255

Fasta

 

>putative glutamine amidotransferase YafJ E. coli K12. Version NC_000913.3 GI:556503834
MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKGCRTFKDPQPSFNSPI
AKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWTYAHNGQLTGYKSLETG
NFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMAAVFKYIASLADELRQKGVFNMLLSDGR
YVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDVVTVIATQPLTGNETWQKI
MPGEWRLFCLGERVV
              
                            

Download fasta file
RegulonDB