RegulonDB RegulonDB 11.1: Amino acid Sequence
antitoxin/DNA-binding transcriptional repressor DinJ Amino Acid Sequence


Size: 86

Fasta

 

>antitoxin/DNA-binding transcriptional repressor DinJ E. coli K12. Version NC_000913.3 GI:556503834
MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFDLREPNQLTIQ
SIKNSEAGIDVHKAKDADDLFDKLGI
              
                            

Download fasta file
RegulonDB