RegulonDB RegulonDB 11.0: Amino acid Sequence
flagellar system protein, promoterless fragment Amino Acid Sequence


Size: 251

Fasta

 

>flagellar system protein, promoterless fragment E. coli K12. Version NC_000913.3 GI:556503834
MSKSERESIIAALHGQSIFNGGGLSPLNKISPSHPPKPATVAVPEETEKKARDVNEKTAL
LKKKSATELGELATSINTIARDAHMEANLEMEIVPQGLRVLIKDDQNRNMFERGSAKIMP
FFKTLLVELAPVFDSLDNKIIITGHTDAMAYKNNIYNNWNLSGDRALSARRVLEEAGMPE
DKVMQVSAMADQMLLDSKNPQSAGNRRIEIMVLTKSASDTLYQYFGQHGDKVVQPLVQKL
DKQQVLSQRTR
              
                            

Download fasta file
RegulonDB