RegulonDB RegulonDB 10.10: Amino acid Sequence
ribosome-dependent mRNA interferase toxin YafO Amino Acid Sequence


Size: 132

Fasta

 

>ribosome-dependent mRNA interferase toxin YafO E. coli K12. Version NC_000913.3 GI:556503834
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAH
IHLANENNPFPPQLRQFSRTNDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHK
IGKMAEAFRMRF
              
                            

Download fasta file
RegulonDB