RegulonDB RegulonDB 10.9: Amino acid Sequence
RNA ligase superfamily protein YkfJ Amino Acid Sequence


Size: 88

Fasta

 

>RNA ligase superfamily protein YkfJ E. coli K12. Version NC_000913.3 GI:556503834
MEWYMGKYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQRVVGMPDLHPGRGYPI
GAAFFSVGRFYPARRRGNGAGNRNGPLL
              
                            

Download fasta file
RegulonDB