RegulonDB RegulonDB 10.8: Amino acid Sequence
CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system Amino Acid Sequence


Size: 113

Fasta

 

>CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system E. coli K12. Version NC_000913.3 GI:556503834
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLA
DAVNFLVEKYELVRIDRKGFSWQEQSPYLRAADILRARQATGLLRQSRNNVVR
              
                            

Download fasta file
RegulonDB