RegulonDB RegulonDB 10.8: Amino acid Sequence
antitoxin of the YkfI-YafW toxin-antitoxin pair Amino Acid Sequence


Size: 105

Fasta

 

>antitoxin of the YkfI-YafW toxin-antitoxin pair E. coli K12. Version NC_000913.3 GI:556503834
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQME
SMLTTGELSPHHAHCVTLYHNDLTCEADTLGSCGYVYIAIYPTQR
              
                            

Download fasta file
RegulonDB