RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-6 prophage; IS911A regulator fragment Amino Acid Sequence


Size: 229

Fasta

 

>CP4-6 prophage; IS911A regulator fragment E. coli K12. Version NC_000913.3 GI:556503834
MKKRNFSAEFKRESAQLVVDQNYTVADAASAMDVGLSTMTRWVKQLRDERQGKTPKASPI
TPEQIEIRELRKKLQRIEMENEILKKATALLMSDSLNSSR*SGNSGRVILWPLSAMCSGF
IAAATNTGKTVLKSQTADGLYYAVRYLNCMASATALPEQEASPQWQPREDTRWGAGLLAD
S*KSWGWSVASSRLTGISVAVMSTLLSRIILSDSSP*RNQIRCGAVM*P
              
                            

Download fasta file
RegulonDB