RegulonDB RegulonDB 10.9: Amino acid Sequence
IS30 transposase Amino Acid Sequence


Size: 383

Fasta

 

>IS30 transposase E. coli K12. Version NC_000913.3 GI:556503834
MRRTFTAEEKASVFELWKNGTGFSEIANILGSKPGTIFTMLRDTGGIKPHERKRAVAHLT
LSEREEIRAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRP
KPCLLDQNLPLRKLVLEKLEMKWSPEQISGWLRRTKPRQKTLRISPETIYKTLYFRSREA
LHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHERSRNIDNRRSLGHWEGDLVS
GTKNSHIATLVDRKSRYTIIVRLRGKDSVSVNQALTDKFLSLPSELRKSLTWDRGMELAR
HLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHELDLVAAQLNN
RPRKTLKFKTPKEIIERGVALTD
              
                            

Download fasta file
RegulonDB