RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-6 prophage; S-methyl-L-methionine transporter Amino Acid Sequence


Size: 467

Fasta

 

>S-methyl-L-methionine transporter E. coli K12. Version NC_000913.3 GI:556503834
MQTTQQNAPLKRTMKTRHLIMLSLGGVIGTGLFFNTGYIISTTGAAGTLLAYLIGALVVW
LVMQCLGELSVAMPETGAFHVYAARYLGPATGYTVAWLYWLTWTVALGSSFTAAGFCMQY
WFPQVPVWVWCVVFCAIIFGLNVISTRFFAEGEFWFSLVKVVTIIAFIILGGAAIFGFIP
MQDGSPAPGLSNITAEGWFPHGGLPILMTMVAVNFAFSGTELIGIAAGETENPRKVIPVA
IRTTIARLIIFFIGTVFVLAALIPMQQVGVEKSPFVLVFEKVGIPYAADIFNFVILTAIL
SAANSGLYASGRMLWSLSNERTLPACFARVTKNGVPLTALSVSMLGGVLALFSSVVAPDT
VFVALSAISGFAVVAVWLSICASHFVFRRRHLQQGKALSELHYRAPWYPLVPVLGFVLCL
VACVGLAFDPAQRIALWCGLPFVALCYGAYFLTQPRNAKQEPEHVAE
              
                            

Download fasta file
RegulonDB