RegulonDB RegulonDB 10.10: Amino acid Sequence
CP4-6 prophage; homocysteine S-methyltransferase Amino Acid Sequence


Size: 310

Fasta

 

>homocysteine S-methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MSQNNPLRALLDKQDILLLDGAMATELEARGCNLADSLWSAKVLVENPELIREVHLDYYR
AGAQCAITASYQATPAGFAARGLDEAQSKALIGKSVELARKAREAYLAENPQAGTLLVAG
SVGPYGAYLADGSEYRGDYHCSVEAFQAFHRPRVEALLDAGADLLACETLPNFSEIEALA
ELLTAYPRARAWFSFTLRDSEHLSDGTPLRDVVALLAGYPQVVALGINCIALENTTAALQ
HLHGLTVLPLVVYPNSGEHYDAVSKTWHHHGEHCAQLADYLPQWQAAGARLIGGCCRTTP
ADIAALKARS
              
                            

Download fasta file
RegulonDB