RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-6 prophage; ABC transporter membrane protein AfuB Amino Acid Sequence


Size: 115

Fasta

 

>CP4-6 prophage; ABC transporter membrane protein AfuB E. coli K12. Version NC_000913.3 GI:556503834
MPNR*IAR*SLTQPARRFPAYHYAHPAAAAAPGDPLGADLQLCARHYHRQRHCVPRHAGY
PRSDGLHPQPRGRWRIRCSDCLRFHSDRGDAGDYFHL*LADR*ITYLPFKSQKPG
              
                            

Download fasta file
RegulonDB