RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-6 prophage; putative D-xylonate transporter YagG Amino Acid Sequence


Size: 460

Fasta

 

>putative D-xylonate transporter YagG E. coli K12. Version NC_000913.3 GI:556503834
MTQLTMKDKIGYGLGDTACGFVWQATMFLLAYFYTDVFGLSAGIMGTLFLVSRVLDAVTD
PLMGLLVDRTRTRHGQFRPFLLWGAIPFGIVCVLTFYTPDFSAQGKIIYACVTYILLTLV
YTFVNVPYCAMPGVITADPKERHALQSWRFFLAAAGSLAISGIALPLVSIIGKGDEQVGY
FGAMCVLGLSGVVLLYVCFFTTKERYTFEVQPGSSVAKDLKLLLGNSQWRIMCAFKMMAT
CSNVVRGGATLYFVKYVMDHPELATQFLLYGSLATMFGSLCSSRLLGRFDRVTAFKWIIV
AYSLISLLIFVTPAEHIALIFALNILFLFVFNTTTPLQWLMASDVVDYEESRSGRRLDGL
VFSTYLFSLKIGLAIGGAVVGWILAYVNYSASSSVQPVEVLTTIKILFCVVPVVLYAGMF
IMLSLYKLTDARVEAISRQLIKHRAAQGEAVPDAATAASH
              
                            

Download fasta file
RegulonDB