RegulonDB RegulonDB 11.0: Amino acid Sequence
CP4-6 prophage; putative xylosidase/arabinosidase Amino Acid Sequence


Size: 536

Fasta

 

>CP4-6 prophage; putative xylosidase/arabinosidase E. coli K12. Version NC_000913.3 GI:556503834
MEITNPILTGFNPDPSLCRQGEDYYIATSTFEWFPGVRIYHSRDLKNWSLVSTPLDRVSM
LDMKGNPDSGGIWAPCLSYADGKFWLLYTDVKIVDSPWKNGRNFLVTAPSIEGPWSEPIP
MGNGGFDPSLFHDDDGRKYYIYRPWGPRHHSNPHNTIVLQAFDPQTGTLSPERKTLFTGT
PLCYTEGAHLYRHAGWYYLMAAEGGTSYEHAVVVLRSKNIDGPYELHPDVTMMTSWHLPE
NPLQKSGHGSLLQTHTGEWYMAYLTSRPLRLPGVPLLASGGRGYCPLGRETGIARIEWRD
GWPYVEGGKHAQLTVKGPQVAEQPAAVPGNWRDDFDASSLDPELQTLRIPFDDTLGSLTA
RPGFLRLYGNDSLNSTFTQSTVARRWQHFAFRAETRMEFSPVHFQQSAGLTCYYNSKNWS
YCFVDYEEGQGRTIKVIQLDHNVPSWPLHEQPIPVPEHAESVWLRVDVDTLVYRYSYSFD
GETWHTVPVTYEAWKLSDDYIGGRGFFTGAFVGLHCEDISGDGCYADFDYFTYEPV
              
                            

Download fasta file
RegulonDB