RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-6 prophage; DNA-binding transcriptional repressor XynR Amino Acid Sequence


Size: 252

Fasta

 

>CP4-6 prophage; DNA-binding transcriptional repressor XynR E. coli K12. Version NC_000913.3 GI:556503834
MPIIQSVERALQILDLFNEQATELKITDISKLMGLSKSTLHSLLKTLQLHGYIDQNPENG
KYRLGMKLVERGHFVVGSIDIRQKAKGWLTELSRRTGQTTHLGILDGREGVYIEKIEGKL
AAIAYSRIGRRLPVHATAIGKVLIAWLGEAELNALLEGYQYTTFTPATLASREALMSALA
QTREQGYALDSEENEQGVRCVAVPVWNHESRVIAALSLSTLTSRVDDAELANFREQLQQA
GLALSRALGYPA
              
                            

Download fasta file
RegulonDB