RegulonDB RegulonDB 10.9: Amino acid Sequence
putative LysR family substrate binding domain-containing protein YagP Amino Acid Sequence


Size: 136

Fasta

 

>putative LysR family substrate binding domain-containing protein YagP E. coli K12. Version NC_000913.3 GI:556503834
MPAPVVLILAAGRGECFLASGGNTHKCIGWRQSPEVAPYRWPFEENGRTFDLAIEPQITT
NDLRLMLRLALAGGGITIATQETFRPYIESGKLVSLLDDFLPQFPGFYLYFPQRRNIAPK
LRALIDYVKEWRQQLA
              
                            

Download fasta file
RegulonDB