RegulonDB RegulonDB 10.9: Amino acid Sequence
molybdenum cofactor insertion chaperone PaoD Amino Acid Sequence


Size: 318

Fasta

 

>molybdenum cofactor insertion chaperone PaoD E. coli K12. Version NC_000913.3 GI:556503834
MSYPLFDKDEHWHKPEQAFLTDDHRTILRFAVEALMSGKGAVLVTLVEIRGGAARPLGAQ
MVVREDGRYCGFVSGGCVEAAAAFEALEMMGSGRDREIRYGEGSPWFDIVLPCGGGITLT
LHKLRSAQPLLAVLNRLEQRKPVGLRYDPQAQSLVCLPTQTRTGWNLNGFEVGFRPCVRL
MIYGRSLEAQATASLAAATGYDSHIFDLFPASASAQIDTDTAVILLCHDLNRELPVLQAA
REAKPFYLGALGSYRTHTLRLQKLHELGWSREETTQIRAPVGIFPKARDAHTLALSVLAE
VASVRLHQEEDSCLPPSS
              
                            

Download fasta file
RegulonDB