RegulonDB RegulonDB 10.10: Amino acid Sequence
putative metal-chelating domain-containing protein YkgJ Amino Acid Sequence


Size: 109

Fasta

 

>putative zinc- or iron-chelating domain-containing protein YkgJ E. coli K12. Version NC_000913.3 GI:556503834
MSNLNPCMTCGACCAFFRVSFYWAEADDAGGTIPARLTEQISPFHRCMSGTNQKNPRCIA
LAGTPGKNACCTIYKNRSSTCREFAMSGENGVVNEACNRARAKYGLTPL
              
                            

Download fasta file
RegulonDB