RegulonDB RegulonDB 10.9: Amino acid Sequence
putative fimbrial chaperone EcpE Amino Acid Sequence


Size: 236

Fasta

 

>putative fimbrial chaperone EcpE E. coli K12. Version NC_000913.3 GI:556503834
MFRRRGVTLTKALLTAVCMLAAPLTQAISVGNLTFSLPSETDFVSKRVVNNNKSARIYRI
AISAIDSPGSSELRTRPVDGELLFAPRQLALQAGESEYFKFYYHGPRDNRERYYRVSFRE
VPTRNHTRRSPTGGVVSTEPVVVMDTILVVRPRQVQFKWSFDKVTGTVSNTGNTWFKLLI
KPGCDSTEEEGDAWYLRPGDVVHQPELRQPGNHYLVYNDKFIKISDSCPAKPPSAD
              
                            

Download fasta file
RegulonDB