RegulonDB RegulonDB 10.9: Amino acid Sequence
fimbrial adhesin EcpD Amino Acid Sequence


Size: 547

Fasta

 

>fimbrial adhesin EcpD E. coli K12. Version NC_000913.3 GI:556503834
MRVNLLITMIIFALIWPVTALRAAVSKTTWADAPAREFVFVENNSDDNFFVTPGGALDPR
LTGANRWTGLKYTGSGTIYQQSLGYIDNGYNTGLYTNWKFDMWLENSPVSSPLTGLRCIN
WYAGCNMTTSLILPQTTDASGFYGATVTSGGAKWMHGMLSDAFYQYMQQMPVGSSFTMTI
NACQTSVNYDASSGARCKDQASGNWYVRNVTHTKAANLRLINTHSLAEVFINSDGVPTLG
EGNADCRTQTIGSRSGLSCKMVNYTLQTNGLSNTSIHIFPAIANSSLASAVGAYDMQFSL
NGSSWKPVSNTAYYYTFNEMKSADSIYVFFSSNFFKQMVNLGISDINTKDLFNFRFQNTT
SPESGWYEFSTSNTLIIKPRDFSISIISDEYTQTPSREGYVGSGESALDFGYIVTTSGKT
AADEVLIKVTGPAQVIGGRSYCVFSSDDGKAKVPFPATLSFITRNGATKTYDAGCDDSWR
DMTDALWLTTPWTDISGEVGQMDKTTVKFSIPMDNAISLRTVDDNGWFGEVSASGEIHVQ
ATWRNIN
              
                            

Download fasta file
RegulonDB