RegulonDB RegulonDB 10.9: Amino acid Sequence
putative amino acid dehydrogenase with NAD(P)-binding domain and ferridoxin-like domain Amino Acid Sequence


Size: 475

Fasta

 

>putative amino acid dehydrogenase with NAD(P)-binding domain and ferridoxin-like domain E. coli K12. Version NC_000913.3 GI:556503834
MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDELGHWEEWRDRAAQIRD
HVLSNLDAYLYQLSEKVTQNGGHVYFARTKEDATRYILQVAQRKNARKVVKSKSMVTEEI
GVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRHQIRRVLHERLGYEGPET
PEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNEGNARMCTTLPKTHIAVMG
MERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAGHVDGPEEFHLVIVDNGRSE
VLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGPIGAVISPLLGGYKDFKDLPY
ACSLCTACDNVCPVRIPLSKLILRHRRVMAEKGITAKAEQRAIKMFAYANSHPGLWKVGM
MAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGESFRSWFKKHQAQEKKNG
              
                            

Download fasta file
RegulonDB