RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF162 domain-containing lactate utilization protein YkgG Amino Acid Sequence


Size: 231

Fasta

 

>DUF162 domain-containing lactate utilization protein YkgG E. coli K12. Version NC_000913.3 GI:556503834
MDNRGEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQRCDAFIQFASDVMLT
RCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQQECNAVVWDPAKGAEN
ISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPEYSLFILRKSTILPRVAQLA
EKLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVKAVYLIIEDC
              
                            

Download fasta file
RegulonDB