RegulonDB RegulonDB 10.9: Amino acid Sequence
ankyrin repeat-containing protein YahD Amino Acid Sequence


Size: 201

Fasta

 

>ankyrin repeat-containing protein YahD E. coli K12. Version NC_000913.3 GI:556503834
MSIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCDRQGKTAITLASLYQQYACVQALID
AGADINKQDHTCLNPFLISCLNDDLTLLRIILPAKPDLNCVTRFGGVGLTPACEKGHLSI
VKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLLLEHGASPHLTDKYGKTP
LELARERGFEEIAQLLIAAGA
              
                            

Download fasta file
RegulonDB