RegulonDB RegulonDB 10.10: Amino acid Sequence
amidohydrolase family protein YahJ Amino Acid Sequence


Size: 460

Fasta

 

>putative deaminase with metallo-dependent hydrolase domain E. coli K12. Version NC_000913.3 GI:556503834
MKESNSRREFLSQSGKMVTAAALFGTSVPLAHAAVAGTLNCEANNTMKITDPHYYLDNVL
LETGFDYENGVAVQTRTARQTVEIQDGKIVALRENKLHPDATLPHYDAGGKLMLPTTRDM
HIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQERAEKLIDLLQSKGTTI
ARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGLLLSKSEPLMREAMQAGAH
YVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTPAGVAAINYMVETVEKTPQL
KGKLTISHAFALATLNEQQVDELANRMVVQQISIASTVPIGTLHMPLKQLHDKGVKVMTG
TDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSLFLATGDVLPLNEKGERVWPKA
QDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSVAG
              
                            

Download fasta file
RegulonDB