RegulonDB RegulonDB 10.9: Amino acid Sequence
uncharacterized protein YahM Amino Acid Sequence


Size: 81

Fasta

 

>uncharacterized protein YahM E. coli K12. Version NC_000913.3 GI:556503834
MAVQLFKTLLNQIPLLSSLQSGTLPLFGYSGWGRPMKKAHTGESGLKWEAKDSSKLIGNK
DHALRGLSSPMAVIRQIRLIT
              
                            

Download fasta file
RegulonDB