RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1471 domain-containing protein YahO Amino Acid Sequence


Size: 91

Fasta

 

>DUF1471 domain-containing protein YahO E. coli K12. Version NC_000913.3 GI:556503834
MKIISKMLVGALALAVTNVYAAELMTKAEFEKVESQYEKIGDISTSNEMSTADAKEDLIK
KADEKGADVLVLTSGQTDNKIHGTANIYKKK
              
                            

Download fasta file
RegulonDB