RegulonDB RegulonDB 11.1: Amino acid Sequence
3-hydroxyphenylpropionate/3-hydroxycinnamate:H+ symporter Amino Acid Sequence


Size: 403

Fasta

 

>3-hydroxyphenylpropionate/3-hydroxycinnamate:H+ symporter E. coli K12. Version NC_000913.3 GI:556503834
MSTRTPSSSSSRLMLTIGLCFLVALMEGLDLQAAGIAAGGIAQAFALDKMQMGWIFSAGI
LGLLPGALVGGMLADRYGRKRILIGSVALFGLFSLATAIAWDFPSLVFARLMTGVGLGAA
LPNLIALTSEAAGPRFRGTAVSLMYCGVPIGAALAATLGFAGANLAWQTVFWVGGVVPLI
LVPLLMRWLPESAVFAGEKQSAPPLRALFAPETATATLLLWLCYFFTLLVVYMLINWLPL
LLVEQGFQPSQAAGVMFALQMGAASGTLMLGALMDKLRPVTMSLLIYSGMLASLLALGTV
SSFNGMLLAGFVAGLFATGGQSVLYALAPLFYSSQIRATGVGTAVAVGRLGAMSGPLLAG
KMLALGTGTVGVMAASAPGILVAGLAVFILMSRRSRIQPCADA
              
                            

Download fasta file
RegulonDB