RegulonDB RegulonDB 10.9: Amino acid Sequence
IS2 element protein InsA Amino Acid Sequence


Size: 121

Fasta

 

>IS2 element protein InsA E. coli K12. Version NC_000913.3 GI:556503834
MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTA
VAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVEYGRAKKWIAHAPLLPGDG
E
              
                            

Download fasta file
RegulonDB