RegulonDB RegulonDB 10.9: Amino acid Sequence
IS2 element protein Amino Acid Sequence


Size: 301

Fasta

 

>IS2 element protein E. coli K12. Version NC_000913.3 GI:556503834
MDSARALIARGWGVSLVSRCLRVSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVI
GELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLERKPAVPPSKRAHTGRV
AVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAV
ERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTI
KRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRACNGLSDNRCLE
I
              
                            

Download fasta file
RegulonDB