RegulonDB RegulonDB 10.9: Amino acid Sequence
putative deacetylase YaiS Amino Acid Sequence


Size: 185

Fasta

 

>putative deacetylase YaiS E. coli K12. Version NC_000913.3 GI:556503834
MDKVLDSALLSSANKRKGILAIGAHPDDIELGCGASLARLAQKGIYIAAVVMTTGNSGTD
GIIDRHEESRNALKILGCHQTIHLNFADTRAHLQLNDMISALEDIIKNQIPSDVEIMRVY
TMHDADRHQDHLAVYQASMVACRTIPQILGYETPSTWLSFMPQVFESVKEEYFTVKLAAL
KKHKS
              
                            

Download fasta file
RegulonDB