RegulonDB RegulonDB 10.9: Amino acid Sequence
surface-exposed outer membrane lipoprotein Amino Acid Sequence


Size: 364

Fasta

 

>surface-exposed outer membrane lipoprotein E. coli K12. Version NC_000913.3 GI:556503834
MSRVNPLSSLSLLAVLVLAGCSSQAPQPLKKGEKAIDVASVVRQKMPASVKDRDAWAKDL
ATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQEIDRRAERMHIPAFLV
HTALKIKSPNGKSYSERLDSVRTEKQLSAIFDDLINMVPMGQTLFGSLNPVRTGGPMQVS
IAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPASYSAPIYRFADFNAGWYA
SRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRKLAAKLGMSDSEIRRQLEKG
DSFSFEETALYKKVYQLAETKTGKSLPREMLPGIQLESPKITRNLTTAWFAKRVDERRAR
CMKQ
              
                            

Download fasta file
RegulonDB