RegulonDB RegulonDB 10.9: Amino acid Sequence
2-dehydropantoate 2-reductase Amino Acid Sequence


Size: 303

Fasta

 

>2-dehydropantoate 2-reductase E. coli K12. Version NC_000913.3 GI:556503834
MKITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETDGSIFNESLTANDPDF
LATSDLLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNIQQPLLMGTTTH
AARRDGNVIIHVANGITHIGPARQQDGDYSYLADILQTVLPDVAWHNNIRAELWRKLAVN
CVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHTSAEDLRDYVMQVIDATAE
NISSMLQDIRALRHTEIDYINGFLLRRARAHGIAVPENTRLFEMVKRKESEYERIGTGLP
RPW
              
                            

Download fasta file
RegulonDB