RegulonDB RegulonDB 10.9: Amino acid Sequence
helix-hairpin-helix 3 family protein Amino Acid Sequence


Size: 123

Fasta

 

>helix-hairpin-helix 3 family protein E. coli K12. Version NC_000913.3 GI:556503834
MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQSKAAVPAKASDEEGT
RVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLKQVPGMGNSLVERNLAV
LTL
              
                            

Download fasta file
RegulonDB