RegulonDB RegulonDB 10.9: Amino acid Sequence
long-chain acyl-CoA thioesterase FadM Amino Acid Sequence


Size: 132

Fasta

 

>thioesterase III E. coli K12. Version NC_000913.3 GI:556503834
MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMTAHNIAFVVVNININY
RRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALITFVCIDLKTQKALALE
GELREKLEQMVK
              
                            

Download fasta file
RegulonDB