RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA base-flipping protein Amino Acid Sequence


Size: 129

Fasta

 

>DNA base-flipping protein E. coli K12. Version NC_000913.3 GI:556503834
MLVSCAMRLHSGVFPDYAEKLPQEEKMEKEDSFPQRVWQIVAAIPEGYVTTYGDVAKLAG
SPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQRQALLAEGVMVSGSGQI
DLQRYRWNY
              
                            

Download fasta file
RegulonDB